PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LPERR05G05550.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Leersia
Family MIKC_MADS
Protein Properties Length: 268aa    MW: 30646.5 Da    PI: 8.9641
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LPERR05G05550.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF99.71.2e-314797151
                     S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
           SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                     krien++nrqvtf+kRrng+lKKA+ELSvLCdaeva+i+fss+g+lyeys+
  LPERR05G05550.1 47 KRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYSN 97
                     79***********************************************95 PP

2K-box104.71.2e-34114210399
            K-box   3 kssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrk 96 
                      +s+++ ++e +a+++qqe+akLk++i nLq+++R l+G+++++++++eL+qLe +L+k+l +iR++Knell+++ie++q++e elq++n +L++
  LPERR05G05550.1 114 TSNSSTVAEINAQHYQQESAKLKQQITNLQNSNRTLVGDSITTMNHRELKQLEARLDKGLGRIRARKNELLCAEIEYMQRREMELQNDNVYLKS 207
                      34444499************************************************************************************** PP

            K-box  97 kle 99 
                      k+ 
  LPERR05G05550.1 208 KVV 210
                      986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006632.593999IPR002100Transcription factor, MADS-box
SMARTSM004322.8E-403998IPR002100Transcription factor, MADS-box
SuperFamilySSF554559.16E-3341112IPR002100Transcription factor, MADS-box
PRINTSPR004047.8E-334161IPR002100Transcription factor, MADS-box
PROSITE patternPS0035004195IPR002100Transcription factor, MADS-box
CDDcd002651.49E-4441113No hitNo description
PfamPF003191.1E-264895IPR002100Transcription factor, MADS-box
PRINTSPR004047.8E-336176IPR002100Transcription factor, MADS-box
PRINTSPR004047.8E-337697IPR002100Transcription factor, MADS-box
PfamPF014862.9E-25124209IPR002487Transcription factor, K-box
PROSITE profilePS5129714.22125215IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 268 aa     Download sequence    Send to blast
MHIYEEQDAE PSTGRMVKEV TAPSPGSGGL GSVGAEKIGS RGKIEIKRIE NTTNRQVTFC  60
KRRNGLLKKA YELSVLCDAE VALIVFSSRG RLYEYSNNSV KATIERYKKA NSDTSNSSTV  120
AEINAQHYQQ ESAKLKQQIT NLQNSNRTLV GDSITTMNHR ELKQLEARLD KGLGRIRARK  180
NELLCAEIEY MQRREMELQN DNVYLKSKVV ESERGLQTVN MMGSASTSEY VQNMIHYDPR  240
NFLQFNIMQQ PQYYPEQEDR KAFISDER
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3kov_A1e-1941126290Myocyte-specific enhancer factor 2A
3kov_B1e-1941126290Myocyte-specific enhancer factor 2A
3kov_I1e-1941126290Myocyte-specific enhancer factor 2A
3kov_J1e-1941126290Myocyte-specific enhancer factor 2A
3p57_A1e-1941126290Myocyte-specific enhancer factor 2A
3p57_B1e-1941126290Myocyte-specific enhancer factor 2A
3p57_C1e-1941126290Myocyte-specific enhancer factor 2A
3p57_D1e-1941126290Myocyte-specific enhancer factor 2A
3p57_I1e-1941126290Myocyte-specific enhancer factor 2A
3p57_J1e-1941126290Myocyte-specific enhancer factor 2A
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB2321570.0AB232157.1 Oryza sativa Japonica Group mRNA for transcription factor OsMADS58, complete cds.
GenBankFJ7509420.0FJ750942.1 Oryza sativa clone KCS268A08 MADS-box transcription factor 58 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015638060.11e-171PREDICTED: MADS-box transcription factor 58
SwissprotQ2V0P11e-174MAD58_ORYSJ; MADS-box transcription factor 58
TrEMBLA0A0D9WDR70.0A0A0D9WDR7_9ORYZ; Uncharacterized protein
STRINGLOC_Os05g11414.11e-170(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP64937144
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18960.13e-96MIKC_MADS family protein